PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C021284P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 296aa    MW: 34174.4 Da    PI: 6.5252
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C021284P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT+eEd++l+++++  G g+W++ ++  g+ R++k+c++rw +yl
   MELO3C021284P1 14 RGRWTAEEDDKLKKYIEANGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     8*******************************99************97 PP

2Myb_DNA-binding55.41.4e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T++Ede ++++++ lG++ W++Ia +++ gRt++++k++w+++l
   MELO3C021284P1  67 RGNITPQEDETILKLHTTLGNR-WSLIAGHLP-GRTDNEIKNYWNSHL 112
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-22564IPR009057Homeodomain-like
PROSITE profilePS5129417.148961IPR017930Myb domain
SuperFamilySSF466891.44E-2811108IPR009057Homeodomain-like
SMARTSM007172.9E-121363IPR001005SANT/Myb domain
PfamPF002498.6E-151461IPR001005SANT/Myb domain
CDDcd001676.66E-81661No hitNo description
PROSITE profilePS5129424.79362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-2665116IPR009057Homeodomain-like
SMARTSM007171.3E-1566114IPR001005SANT/Myb domain
PfamPF002497.0E-1567112IPR001005SANT/Myb domain
CDDcd001674.94E-971112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009813Biological Processflavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MGRTPCCEKE GLRRGRWTAE EDDKLKKYIE ANGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRTDLKRGNI TPQEDETILK LHTTLGNRWS LIAGHLPGRT DNEIKNYWNS HLSKKIYSDT  120
KKDSPQESTI PKRGRPNNKQ QTIIAKKNKK KTIPNEESCQ SNSIPETTNN NKPKEQEEHA  180
TTSSSSEKEP NRNDHNNKKK NNNSTTKDPK IEEEHWEFTT DDGEKVENEV ISTIIESGEW  240
FYSSWPSSNF NNEWMNWDWE SDGVLGQNVQ EPSSWFWANN NNDNNTNGEG EEECR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A1e-22141352119MYB3
3zqc_D1e-22141352119MYB3
3zqc_G1e-22141352119MYB3
3zqc_J1e-22141352119MYB3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819240.0LN681924.1 Cucumis melo genomic scaffold, anchoredscaffold00047.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008458382.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0L9TWH02e-71A0A0L9TWH0_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SSH32e-71A0A0S3SSH3_PHAAN; Uncharacterized protein
TrEMBLD5FFI03e-71D5FFI0_MEDTR; MYB transcription factor MYB112
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.11e-69myb domain protein 12